Naik
Harga
-
Warna
Selanjutnya
2758 produk ditemukan

Simak ulasan lengkap mengenai ragam produk suplemen makanan berupa multivitamin yang ada di iprice Indonesia serta tips mudah untuk memenuhi nutrisi Anda secara alami hanya di artikel berikut.

Kunjungi Toko
Blackmores Pregnancy & Breastfeeding at 925000.00 IDR from Lazada
Blackmores Pregnancy & Breastfeeding
Rp 925.000
Lazada
Kunjungi Toko
Blackmores Radiance Marine BPOM Kesehatan Kulit Collagen Q10 30 Kapsul at 345000.00 IDR from Lazada
-20%
Blackmores Radiance Marine BPOM Kesehatan Kulit Collagen Q10 30 Kapsul
Rp 345.000 Rp 435.000
Lazada
Kunjungi Toko
Blackmores Premium Omega 3 Odorless Fish Oil 1000mg 400caps at 349000.00 IDR from Lazada
-65%
Blackmores Premium Omega 3 Odorless Fish Oil 1000mg 400caps
Rp 349.000 Rp 999.000
Lazada
Kunjungi Toko
Blackmores Glucosamine Sulfate 1500mg 90 Tablets at 551000.00 IDR from Lazada
Blackmores Glucosamine Sulfate 1500mg 90 Tablets
Rp 551.000
Lazada
Kunjungi Toko
GNC [macyskorea] Gnc mega men GNC Mega Men One Daily Multivitamin, Caplets/5879102 at 521000.00 IDR from elevenia
GNC [macyskorea] Gnc mega men GNC Mega Men One Daily Multivitamin, Caplets/5879102
Rp 521.000
elevenia
Kunjungi Toko
Blackmores Blackmores I-Folic BPOM Kalbe - 150 Tablet at 180000.00 IDR from Matahari Mall
-18%
Blackmores Blackmores I-Folic BPOM Kalbe - 150 Tablet
Rp 180.000 Rp 220.000
Matahari Mall
Isi 150 tablet,Expire Mei 2019,Made in Australia (Imported by Kalbe Blackmores),Membantu perkembangan otak, penglihatan dan pendengaran janin,Mengurangi resiko cacat lahir pada otak dan / atau sumsum tulang belakang
Selengkapnya
Kunjungi Toko
Nature's Plus Regeneration 90's Multivitamin Detox Antioksidan Imunitas Detoks at 635000.00 IDR from Lazada
-67%
Nature's Plus Regeneration 90's Multivitamin Detox Antioksidan Imunitas Detoks
Rp 635.000 Rp 1.967.000
Lazada
Kunjungi Toko
Kirkland Signature Kirkland Adult Multivitamin & Mineral (1690㎎ x 400 tablets) / adult multivitamin / mineral supplement / 652844 at 319000.00 IDR from elevenia
Kirkland Signature Kirkland Adult Multivitamin & Mineral (1690㎎ x 400 tablets) / adult multivitamin / mineral supplement / 652844
Rp 319.000
elevenia
Kunjungi Toko
Blackmores Nail Hair & Skin Biotin 60 Tablets at 299000.00 IDR from Lazada
-50%
Blackmores Nail Hair & Skin Biotin 60 Tablets
Rp 299.000 Rp 599.000
Lazada
Kunjungi Toko
Wellness WELLNESS MULTIVITAMIN / MINERAL 2-A-DAY (120) | Antioksidan at 606000.00 IDR from elevenia
Wellness WELLNESS MULTIVITAMIN / MINERAL 2-A-DAY (120) | Antioksidan
Rp 606.000
elevenia
Kunjungi Toko
Wellness Multivitamin 2 A Day 120s at 408000.00 IDR from Lazada
-20%
Wellness Multivitamin 2 A Day 120s
Rp 408.000 Rp 510.000
Lazada
Kunjungi Toko
Blackmores Vitamin B6 42 Tablet at 180000.00 IDR from Lazada
Blackmores Vitamin B6 42 Tablet
Rp 180.000
Lazada
Kunjungi Toko
Blackmores Digestive Aid 60 Capsules at 518000.00 IDR from Lazada
-13%
Blackmores Digestive Aid 60 Capsules
Rp 518.000 Rp 599.000
Lazada
Kunjungi Toko
Blackmores Odourless Fish Oil 1000mg 200 Capsules Ori at 285000.00 IDR from Lazada
-25%
Blackmores Odourless Fish Oil 1000mg 200 Capsules Ori
Rp 285.000 Rp 380.000
Lazada
Kunjungi Toko
Blackmores Pregnancy and Breastfeeding Gold 60 Caps [Bmpbf60C] at 359000.00 IDR from Bhinneka
Blackmores Pregnancy and Breastfeeding Gold 60 Caps [Bmpbf60C]
Rp 359.000
Bhinneka
Suplemen komplit untuk ibu hamil dan menyusui, Membantu mendapatkan nutrisi penting bagi perkembangan bayi Anda, Memberikan nutrisi penting seorang wanita sebelum dan selama kehamilan, dan menyusui
Selengkapnya
Kunjungi Toko
Marinox Selenium ACE 30's Antioxidant, Anti Aging, Meningkatkan Daya Tahan Tubuh, Stamina, Vitalistas, Multivitamin at 209000.00 IDR from Lazada
-67%
Marinox Selenium ACE 30's Antioxidant, Anti Aging, Meningkatkan Daya Tahan Tubuh, Stamina, Vitalistas, Multivitamin
Rp 209.000 Rp 648.000
Lazada
Kunjungi Toko
Blackmores CoQ10 75mg 30 Tablet [Bmq1075Mg30C] at 499000.00 IDR from Bhinneka
Blackmores CoQ10 75mg 30 Tablet [Bmq1075Mg30C]
Rp 499.000
Bhinneka
Antioksidan, Mengurangi oksidasi kolesterol Ldl, Mendukung produksi energi sel, Membantu menjaga arteri yang sehat dan sistem kardiovaskular yang sehat
Selengkapnya
Kunjungi Toko
Century 21St Sentry, Multivitamin & Multimineral Supplement (Merchant) at 620000.00 IDR from Bhinneka
Century 21St Sentry, Multivitamin & Multimineral Supplement (Merchant)
Rp 620.000
Bhinneka
Over 30 Key Nutrients for Complete Nutrition, Compare Active Ingredients to Centrum, For Adults, 130 Tablets
Selengkapnya
Kunjungi Toko
Blackmores Odourless Fish Oil 1000 mg 500 Caps Bulk Pack [Bmbioc-26] at 519000.00 IDR from Bhinneka
Blackmores Odourless Fish Oil 1000 mg 500 Caps Bulk Pack [Bmbioc-26]
Rp 519.000
Bhinneka
Membantu kesehatan jantung dan kardiovaskular, Mengurangi peradangan dan pembengkakan sendi, Membantu pemeliharaan mata normal dan fungsi otak, Sumber Omega-3
Selengkapnya
Kunjungi Toko
Blackmores Conceive Well Men 28 Kapsul [Bmcwm28C] at 599000.00 IDR from Bhinneka
Blackmores Conceive Well Men 28 Kapsul [Bmcwm28C]
Rp 599.000
Bhinneka
Memelihara dan menjaga kesuburan hormon pria, Zinc dan Selenium mendukung produksi sperma, oQ10 dan antioksidan berperan dalam memproduksi energi sel sperma yang optimal
Selengkapnya
Kunjungi Toko
Blackmores Flaxseed Oil 1000mg 100 kapsul Lunak at 248000.00 IDR from Lazada
-10%
Blackmores Flaxseed Oil 1000mg 100 kapsul Lunak
Rp 248.000 Rp 275.000
Lazada
Kunjungi Toko
Blackmores Premium Omega 3 Odorless Fish Oil 1000mg - 400caps at 435000.00 IDR from Bhinneka
Blackmores Premium Omega 3 Odorless Fish Oil 1000mg - 400caps
Rp 435.000
Bhinneka
Menjaga kesehatan jantung & meningkatkan fungsi otak, Menurunkan kolesterol & darah tinggi, Membantu mengatasi rheumatik
Selengkapnya
Kunjungi Toko
Rainbow [macyskorea] Rainbow light Rainbow Light NutriStart Multivitamin Powder/5890606 at 395000.00 IDR from elevenia
Rainbow [macyskorea] Rainbow light Rainbow Light NutriStart Multivitamin Powder/5890606
Rp 395.000
elevenia
Kunjungi Toko
GNC [macyskorea] Gnc mega men GNC Mega Men Heart Multivitamin, Caplets/5879049 at 568000.00 IDR from elevenia
GNC [macyskorea] Gnc mega men GNC Mega Men Heart Multivitamin, Caplets/5879049
Rp 568.000
elevenia
Kunjungi Toko
Swisse Mens Ultivite Multivitamin 60 Tablets at 280000.00 IDR from Lazada
-49%
Swisse Mens Ultivite Multivitamin 60 Tablets
Rp 280.000 Rp 550.000
Lazada
Kunjungi Toko
Blackmores Tranquil Night 60 Caps Suplemen Untuk Membantu Susah Tidur at 275000.00 IDR from Lazada
-38%
Blackmores Tranquil Night 60 Caps Suplemen Untuk Membantu Susah Tidur
Rp 275.000 Rp 450.000
Lazada
Kunjungi Toko
Puritan Pride ABC Senior Plus Multivitamin & Multi-Mineral 120 Kaplet at 256000.00 IDR from Lazada
-57%
Puritan Pride ABC Senior Plus Multivitamin & Multi-Mineral 120 Kaplet
Rp 256.000 Rp 599.000
Lazada
Kunjungi Toko
Marinox Multivitamin Plus 30's Multi-vitamin, Meningkatkan Daya Tahan Tubuh, Imun Tubuh, Kekebalan Tubuh at 205000.00 IDR from Lazada
-67%
Marinox Multivitamin Plus 30's Multi-vitamin, Meningkatkan Daya Tahan Tubuh, Imun Tubuh, Kekebalan Tubuh
Rp 205.000 Rp 636.000
Lazada
Kunjungi Toko
Nature's Plus Source of Life Animal Parade Baby Plex Sugar Free Multivitamin Liquid Drops Natural Orange Flavor 2 fl oz (60 ml) at 187000.00 IDR from iHerb
Nature's Plus Source of Life Animal Parade Baby Plex Sugar Free Multivitamin Liquid Drops Natural Orange Flavor 2 fl oz (60 ml)
Rp 187.000
iHerb
The Energy Supplements Sugar Free‡ Supplement For Infants and Toddlers With Natural Orange Flavor Gluten Free Nutritional Support for Overall Well-Being For pure, natural, safe, and effective nutrition, look to Source of Life Animal Parade Baby Plex, only from Nature's Plus. With quality backed by an independent laboratory assay, Source of Life Animal Parade Baby Plex liquid vitamin formula for infants and toddlers is sugar free‡, with a natural, yummy orange flavor and a convenient dropper applicator. Customized to support your baby's nutritional needs, Source of Life Animal Parade Baby Plex is perfectly balanced for maximum absorption and cellular support, to further assist optimal development and well-being during this important life stage. ‡Dietarily insignificant source of sugar.
Selengkapnya
Kunjungi Toko
Blackmores Horseradish Garlic + Vit C 50 Tab at 220000.00 IDR from Lazada
-51%
Blackmores Horseradish Garlic + Vit C 50 Tab
Rp 220.000 Rp 450.000
Lazada
Kunjungi Toko
Nature's Plus Nature's Plus Woman Multivitamin and Mineral 90 Tablets / antioxidant / multi / general / plant / 38 type / Menopause / parents / gifts / at 647000.00 IDR from elevenia
Nature's Plus Nature's Plus Woman Multivitamin and Mineral 90 Tablets / antioxidant / multi / general / plant / 38 type / Menopause / parents / gifts /
Rp 647.000
elevenia
Kunjungi Toko
Natrol Multivitamin Natrol, Hyaluronic Acid, 40 mg - 30 Capsules at 359000.00 IDR from elevenia
Natrol Multivitamin Natrol, Hyaluronic Acid, 40 mg - 30 Capsules
Rp 359.000
elevenia
Kunjungi Toko
Puritan Puritan's Pride ABC Plus Senior Multivitamin 50+ - 120 Caplets at 182000.00 IDR from elevenia
Puritan Puritan's Pride ABC Plus Senior Multivitamin 50+ - 120 Caplets
Rp 182.000
elevenia
Kunjungi Toko
Blackmores Vitamin B12 Cyanocobalamin 100mcg 75 Tablet at 239000.00 IDR from Lazada
-40%
Blackmores Vitamin B12 Cyanocobalamin 100mcg 75 Tablet
Rp 239.000 Rp 399.000
Lazada
Kunjungi Toko
Blackmores Natural E 100IU 42 Caps at 175000.00 IDR from Lazada
Blackmores Natural E 100IU 42 Caps
Rp 175.000
Lazada
Kunjungi Toko
Kalbe BLACKMORES RADIANCE MARINE Q 10 BPOM 30 TAB at 367000.00 IDR from Lazada
-15%
Kalbe BLACKMORES RADIANCE MARINE Q 10 BPOM 30 TAB
Rp 367.000 Rp 435.000
Lazada
Kunjungi Toko
GNC [macyskorea] Sallyashop GNC Mens Mega Men Multivitamin, Soft Chew, Fruit Punch, 60 ea/6663627 at 986000.00 IDR from elevenia
GNC [macyskorea] Sallyashop GNC Mens Mega Men Multivitamin, Soft Chew, Fruit Punch, 60 ea/6663627
Rp 986.000
elevenia
Kunjungi Toko
Blackmores Super Strength Horseradish garlic + C 90 tablets at 599000.00 IDR from Lazada
-14%
Blackmores Super Strength Horseradish garlic + C 90 tablets
Rp 599.000 Rp 699.000
Lazada
Kunjungi Toko
GNC [macyskorea] Gnc mega men GNC Mega Men Multivitamin, Soft Chew, Fruit Punch/5878950 at 679000.00 IDR from elevenia
GNC [macyskorea] Gnc mega men GNC Mega Men Multivitamin, Soft Chew, Fruit Punch/5878950
Rp 679.000
elevenia
Kunjungi Toko
Life Extension [poledit] Life Extension Super Ubiquinol CoQ10 with Enhanced Mitochondrial Support (T1)/12629652 at 800000.00 IDR from elevenia
Life Extension [poledit] Life Extension Super Ubiquinol CoQ10 with Enhanced Mitochondrial Support (T1)/12629652
Rp 800.000
elevenia
Kunjungi Toko
Blackmores Joint Formula 120 Tablets at 725000.00 IDR from Lazada
-27%
Blackmores Joint Formula 120 Tablets
Rp 725.000 Rp 999.000
Lazada
Kunjungi Toko
Wellness 2-A-Day Multivitamin 120's Imunitas Tubuh, Daya Tahan Tubuh, Kekebalan Tubuh at 398000.00 IDR from Lazada
-67%
Wellness 2-A-Day Multivitamin 120's Imunitas Tubuh, Daya Tahan Tubuh, Kekebalan Tubuh
Rp 398.000 Rp 1.233.000
Lazada
Kunjungi Toko
GNC [macyskorea] AB GNC Mens Ultra Mega Multivitamin Green Sport, Caplets 60 ea/6663251 at 1224000.00 IDR from elevenia
GNC [macyskorea] AB GNC Mens Ultra Mega Multivitamin Green Sport, Caplets 60 ea/6663251
Rp 1.224.000
elevenia
Kunjungi Toko
Doctor's Best High Absorption CoQ10 with BioPerine 100 mg 60 Veggie Caps at 130000.00 IDR from iHerb
Doctor's Best High Absorption CoQ10 with BioPerine 100 mg 60 Veggie Caps
Rp 130.000
iHerb
Science-Based Nutrition Dietary Supplement Supports Heart Function, Energy Production in Cells With BioPerine USP Naturally Fermented Pharmaceutical Grade CoQ10 Vegan USP Pharmaceutical Grade. Fermented Non-GMO and Gluten Free High Absorption CoQ10 contains pure, vegetarian coenzyme Q10, plus BioPerine. CoQ10 is a nutrient that supports heart function and promotes energy production in cells. BioPerine, an herbal extract derived from black pepper fruit, promotes absorption of nutrients in the GI tract. Preliminary studies have shown that BioPerine increases CoQ10 absorption.
Selengkapnya
Kunjungi Toko
Nature's Health Omega 3-6-9 45's Multivitamin Untuk Jantung, Kolesterol, Hipertensi at 216000.00 IDR from Lazada
-67%
Nature's Health Omega 3-6-9 45's Multivitamin Untuk Jantung, Kolesterol, Hipertensi
Rp 216.000 Rp 670.000
Lazada
Kunjungi Toko
Blackmores Radiance Marine Q-10 BPOM Kalbe 30's Vitamin Kulit, Kesehatan Kulit, Suplemen Kulit, Anti Aging, Anti Penuaan Dini, Mengecilkan Pori Pori at 391000.00 IDR from Lazada
-56%
Blackmores Radiance Marine Q-10 BPOM Kalbe 30's Vitamin Kulit, Kesehatan Kulit, Suplemen Kulit, Anti Aging, Anti Penuaan Dini, Mengecilkan Pori Pori
Rp 391.000 Rp 899.000
Lazada
Kunjungi Toko
Nature's Way Multivitamin Super Greens Plus Kale 90 Stamina Daya Tahan at 250000.00 IDR from Lazada
-8%
Nature's Way Multivitamin Super Greens Plus Kale 90 Stamina Daya Tahan
Rp 250.000 Rp 274.000
Lazada
Kunjungi Toko
Puritan Pride Puritan One Daily Men's Multivitamin 100 Caps at 299000.00 IDR from Lazada
-25%
Puritan Pride Puritan One Daily Men's Multivitamin 100 Caps
Rp 299.000 Rp 399.000
Lazada
Kunjungi Toko
Sea-Quill Spectra-3 35's Multivitamin Pencernaan, Daya Tahan Tubuh, Stamina at 231000.00 IDR from Lazada
-67%
Sea-Quill Spectra-3 35's Multivitamin Pencernaan, Daya Tahan Tubuh, Stamina
Rp 231.000 Rp 715.000
Lazada
Kunjungi Toko
Tiens Nonitrend Multivitamin 100 capsulAntioksidan Noni 3x dari Vitamin C at 136000.00 IDR from Lazada
-35%
Tiens Nonitrend Multivitamin 100 capsulAntioksidan Noni 3x dari Vitamin C
Rp 136.000 Rp 210.000
Lazada
Kunjungi Toko
Centrum [macyskorea] Centrum Specialist Energy, Multivitamin Tablets, 60-Count/6702538 at 368000.00 IDR from elevenia
Centrum [macyskorea] Centrum Specialist Energy, Multivitamin Tablets, 60-Count/6702538
Rp 368.000
elevenia
Kunjungi Toko
Rainbow [macyskorea] Rainbow Light, Mens One Multivitamin, 30 Tablets/15958926 at 468000.00 IDR from elevenia
Rainbow [macyskorea] Rainbow Light, Mens One Multivitamin, 30 Tablets/15958926
Rp 468.000
elevenia
Kunjungi Toko
Nature's Plus Nature's Plus Regeneration multivitamin dan mineral 90 softgels at 872000.00 IDR from elevenia
Nature's Plus Nature's Plus Regeneration multivitamin dan mineral 90 softgels
Rp 872.000
elevenia
Kunjungi Toko
Kalbe Cerebrofort Gold Orange 100 Ml Syrup Rasa Jeruk, Multivitamin Anak, Tumbuh Kembang Anak, Nutrisi Otak Anak at 48000.00 IDR from Lazada
-56%
Kalbe Cerebrofort Gold Orange 100 Ml Syrup Rasa Jeruk, Multivitamin Anak, Tumbuh Kembang Anak, Nutrisi Otak Anak
Rp 48.000 Rp 110.000
Lazada
Kunjungi Toko
Nature's Way Multivitamin Plus Spirulina 200 Tablet at 213000.00 IDR from Lazada
-26%
Nature's Way Multivitamin Plus Spirulina 200 Tablet
Rp 213.000 Rp 290.000
Lazada
Kunjungi Toko
Puritan Pride Ultra Man 50 plus Multivitamin at 325000.00 IDR from Lazada
-18%
Puritan Pride Ultra Man 50 plus Multivitamin
Rp 325.000 Rp 400.000
Lazada
Kunjungi Toko
Nature's way Kids Smart Complete Multivitamin + Fish Oil HIGH DHA 50 Caps at 320000.00 IDR from Lazada
Nature's way Kids Smart Complete Multivitamin + Fish Oil HIGH DHA 50 Caps
Rp 320.000
Lazada
Kunjungi Toko
Blackmores Glucosamine Sulfate 1500mg 180 tablet at 350000.00 IDR from Lazada
-5%
Blackmores Glucosamine Sulfate 1500mg 180 tablet
Rp 350.000 Rp 371.000
Lazada
Kunjungi Toko
Wellness Children's Multi Liquid 240 Ml Multivitamin Anak, Penambah Nafsu Makan Anak, Daya Tahan Tubuh Anak at 223000.00 IDR from Lazada
-68%
Wellness Children's Multi Liquid 240 Ml Multivitamin Anak, Penambah Nafsu Makan Anak, Daya Tahan Tubuh Anak
Rp 223.000 Rp 700.000
Lazada
Kunjungi Toko
Blackmores Total Calcium & Magnesium + D3 200 Tablet at 399000.00 IDR from Lazada
-50%
Blackmores Total Calcium & Magnesium + D3 200 Tablet
Rp 399.000 Rp 799.000
Lazada
Kunjungi Toko
Blackmores Omega Daily 90 Kapsul (BPOM Kalbe) at 275000.00 IDR from Lazada
-21%
Blackmores Omega Daily 90 Kapsul (BPOM Kalbe)
Rp 275.000 Rp 350.000
Lazada
Kunjungi Toko
Nature's Way Multivitamin Plus Spirulina 200 Tablet at 700000.00 IDR from Lazada
Nature's Way Multivitamin Plus Spirulina 200 Tablet
Rp 700.000
Lazada
Kunjungi Toko
Blackmores Total Calcium & Magnesium + D3 200 Tablet at 417000.00 IDR from Lazada
-47%
Blackmores Total Calcium & Magnesium + D3 200 Tablet
Rp 417.000 Rp 799.000
Lazada
Kunjungi Toko
Blackmores Blackmores Menopause Day/ Night Relief - 60 Tablet at 475000.00 IDR from Matahari Mall
Blackmores Blackmores Menopause Day/ Night Relief - 60 Tablet
Rp 475.000
Matahari Mall
ExpiredApril2017;Isi60Tablet;Formulasiangharidikombinasikandengandosissoyisoflavonesyangterkonsentrasiuntukmengurangihotflushessaatmenopause;PLUSSiberianGingseng–yangdapatmengurangikelelahan;danSchisandra–yangdigunakandalamobattradisionalChineseuntukmeringankansifatcepatmarahyangterjadisaatmenopause.
Selengkapnya
Kunjungi Toko
Nature's Plus Regeneration Multivitamin Multimineral Detoks 90 softgel at 660000.00 IDR from Lazada
-14%
Nature's Plus Regeneration Multivitamin Multimineral Detoks 90 softgel
Rp 660.000 Rp 769.000
Lazada
Kunjungi Toko
Sea-Quill Sea Quill Kids Plus Multivitamin Syrup at 328000.00 IDR from Lazada
-21%
Sea-Quill Sea Quill Kids Plus Multivitamin Syrup
Rp 328.000 Rp 418.000
Lazada
Kunjungi Toko
Nature's Plus Especially Yours 60's Multivitamin Untuk Wanita, Antioksidan, Meningkatkan Imunitas, Mengurangi PMS, Suplemen Menopause at 449000.00 IDR from Lazada
-67%
Nature's Plus Especially Yours 60's Multivitamin Untuk Wanita, Antioksidan, Meningkatkan Imunitas, Mengurangi PMS, Suplemen Menopause
Rp 449.000 Rp 1.392.000
Lazada
Kunjungi Toko
Blackmores Tranquil Night 60 Caps Suplemen Untuk Membantu Susah Tidur at 279000.00 IDR from Lazada
-38%
Blackmores Tranquil Night 60 Caps Suplemen Untuk Membantu Susah Tidur
Rp 279.000 Rp 450.000
Lazada
Kunjungi Toko
Blackmores Blackmores Odourless Garlic - 200 tablet at 170000.00 IDR from Matahari Mall
-12%
Blackmores Blackmores Odourless Garlic - 200 tablet
Rp 170.000 Rp 195.000
Matahari Mall
meringankan gejala flu dan pilek,Menunjukkan spektrum luas aktivitas antimikroba dan tindakan antibakteri dan sangat aktif terhadap virus influenza,Parsley mengandung klorofil untuk membantu menutupi bau yang khas bawang putih,Imunitas dan membantu cholesterol tubuh
Selengkapnya
Kunjungi Toko
Kalbe BLACKMORES I-FOLIC BPOM 150 TAB at 159000.00 IDR from Lazada
-9%
Kalbe BLACKMORES I-FOLIC BPOM 150 TAB
Rp 159.000 Rp 175.000
Lazada
Kunjungi Toko
Nature's Plus Pow Teen 90's Source Of Life SOL Power Teen Multivitamin Anak, Kalsium Anak, Meningkatkan Daya Tahan Tubuh Anak, Imun Tubuh, Kekebalan Tubuh at 536000.00 IDR from Lazada
-67%
Nature's Plus Pow Teen 90's Source Of Life SOL Power Teen Multivitamin Anak, Kalsium Anak, Meningkatkan Daya Tahan Tubuh Anak, Imun Tubuh, Kekebalan Tubuh
Rp 536.000 Rp 1.662.000
Lazada
Kunjungi Toko
Synplus ABC Plus With Lutein 30's Syn Plus, Multivitamin, Mengobati Anemia, Kurang Darah, Berkunang-kunang, Vitamin Ibu Hamil, Vitamin Ibu Menyusui, Kesehatan Mata at 238000.00 IDR from Lazada
-52%
Synplus ABC Plus With Lutein 30's Syn Plus, Multivitamin, Mengobati Anemia, Kurang Darah, Berkunang-kunang, Vitamin Ibu Hamil, Vitamin Ibu Menyusui, Kesehatan Mata
Rp 238.000 Rp 500.000
Lazada
Kunjungi Toko
Blackmores Blackmores Lutein Vision BPOM SI - 60 Capsules at 485000.00 IDR from Matahari Mall
Blackmores Blackmores Lutein Vision BPOM SI - 60 Capsules
Rp 485.000
Matahari Mall
Expired Januari 2018,Isi 60 Kapsul,No Bpom : POM SI 164 307 161 ,formula antioksidan untuk menjaga kesehatan mata
Selengkapnya
Kunjungi Toko
Blackmores Premium Omega 3 Fish Oil 1000mg 200caps [Bmoo3200Caps] at 279000.00 IDR from Bhinneka
Blackmores Premium Omega 3 Fish Oil 1000mg 200caps [Bmoo3200Caps]
Rp 279.000
Bhinneka
Menjaga kesehatan jantung & meningkatkan fungsi otak, Menurunkan kolesterol & darah tinggi, membantu mengatasi rheumatik, 100% made in Australia
Selengkapnya
Kunjungi Toko
Garden of Life Vitamin Code Kids Chewable Whole Food Multivitamin for Kids Cherry Berry 30 Chewable Bears at 170000.00 IDR from iHerb
Garden of Life Vitamin Code Kids Chewable Whole Food Multivitamin for Kids Cherry Berry 30 Chewable Bears
Rp 170.000
iHerb
Beyond Vitamins and Minerals Yummy! Cherry Berry New and Improved Made with Vitamin Code Vitamins and Minerals 24 Organically Grown Fruits and Veggies Non GMO Project Verified Gluten Free Whole Food Dietary Supplement Chewable Whole Food Multivitamin for Kids Feel the Whole Food Difference! CLEAN Clean whole food ingredients gently blended, never heated, into a base of organically grown fruits and vegetables. No artificial flavors, sweeteners or additives. Non-GMO Project Verified Independent, third party verification. Yummy Whole Food Great taste kids love! Support for a Growing Child's Needs Immune Support Eye Health Digestive Health Mental and Physical Energy Support for Growing Bones Finally, a great tasting Whole Food Multi that supports your child's healthy development! Vitamin Code Kids is the First Non-GMO Verified children's multivitamin - ever! 24 Organically Grown fruits and vegetables for antioxidants, vitamins and cofactors. Whole Food vitamins and minerals to support your active, growing child. Live Probiotics Vegetarian Dairy Free
Selengkapnya
Kunjungi Toko
Country Life Max for Women Multivitamin & Mineral Complex With Iron 120 Tablets at 331000.00 IDR from iHerb
Country Life Max for Women Multivitamin & Mineral Complex With Iron 120 Tablets
Rp 331.000
iHerb
Established 1971 Certified Gluten-Free Includes Ashwagandha Includes Coenzyme B Vitamins Only 2 Tablets Daily Maxi-Sorb Delivery System Dietary Supplement ChromaxOur Pledge of Integrity Authenticity Cleanliness Freshness Consistency AccuracyA multivitamin and multimineral complex that includes key nutrients for women's health such as "coenzymated" B Vitamins for energy metabolism plus Ashwagandha. Max for Women uses Country Life's exclusive Maxi-Sorb delivery system.
Selengkapnya
Kunjungi Toko
Dermalogica AGE Smart Multivitamin Hand & Nail Care 75ml at 319000.00 IDR from Catwalk
Dermalogica AGE Smart Multivitamin Hand & Nail Care 75ml
Rp 319.000
Catwalk
Dermalgoica AGE Smart Multivitamin Hand & Nail Care 75ml An intense, non-greasy treatment that conditions dry, rough hands while helping to reduce nail splitting and peeling. Pro-Vitamin B5 and soothing Algae Extract hydrate and provide an invisible barrier. Licorice Extract and Vitamin C help even out skin tone while Vitamin A (Retinol) helps reverse the signs of premature aging. Extracts of Ginkgo Biloba and Grape Seed plus Vitamin E help guard against environmental damage while quick-absorbing conditioners leave hands smoother and nails healthier. Contains no artificial fragrance or color. Professional recommendation advised. How it works: Pro-vitamin B5 and soothing Algae Extract combine with Grapefruit to help heal dry, rough hands. Antioxidant botanicals Grape Seed Extract, Gingko Biloba and Vitamin E help to defend hands against environmental damage. Licorice Extract and Vitamin C help reduce the appearance of hyperpigmentation ("age spots") while antioxidant extracts of Ginkgo Biloba and Grape seed plus Vitamin E neutralize free radical activity, guarding against further damage.
Selengkapnya
Kunjungi Toko
Kirkland Signature Daily Multi 500 Tablets Multivitamin at 582000.00 IDR from Lazada
Kirkland Signature Daily Multi 500 Tablets Multivitamin
Rp 582.000
Lazada
Kunjungi Toko
Nutracare CoQ10 30's CO Q-10, COQ-10, Suplemen Jantung, Antioksidan, Obat Jantung at 430000.00 IDR from Lazada
-52%
Nutracare CoQ10 30's CO Q-10, COQ-10, Suplemen Jantung, Antioksidan, Obat Jantung
Rp 430.000 Rp 900.000
Lazada
Kunjungi Toko
Natures Own Women's Multivitamin Mega Potency 60 Tablets Anti Aging at 263000.00 IDR from Lazada
Natures Own Women's Multivitamin Mega Potency 60 Tablets Anti Aging
Rp 263.000
Lazada
Kunjungi Toko
Blackmores Total Calcium & Magnesium + D3 200 Tablet [Bmtcm200C] at 375000.00 IDR from Bhinneka
Blackmores Total Calcium & Magnesium + D3 200 Tablet [Bmtcm200C]
Rp 375.000
Bhinneka
Membantu dalam pengaturan keadaan kekurangan kalsium, Dapat membantu dalam pencegahan dan/atau pengobatan Osteoporosis, Untuk kesehatan tulang, Berperan untuk kesehatan otot dan fungsi saraf
Selengkapnya
Kunjungi Toko
Life Extension Super Ubiquinol CoQ10 100 mg 60 Softgels at 565000.00 IDR from iHerb
Life Extension Super Ubiquinol CoQ10 100 mg 60 Softgels
Rp 565.000
iHerb
Enhanced Delivery System for Maximum Absorption Dietary Supplement Kaneka - Made with Quality - Ubiquinol Non-GMOCoenzyme Q10 (CoQ10 for short) is a potent antioxidant that supports cardiovascular health and is absolutely essential for healthy mitochondrial function. The traditional form of CoQ10, ubiquinone, is difficult for your body to absorb — but the ubiquinol form, like that in Super Ubiquinol CoQ10 absorbs up to 8 times better!Benefits at a Glance Supports cardiovascular health Promotes healthy energy production at the cellular level Absorbs up to 8 times better than ubiquinone CoQ10 Provides powerful antioxidant supportCoQ10 and healthy mitochondriaCoQ10 is an essential component of healthy mitochondrial function. The mitochondria are the cell’s energy powerhouses, and CoQ10 is required to convert the energy unlocked from fats and sugars into usable cellular energy.Cardiovascular health and antioxidant defenseBecause of this, CoQ10 is most highly concentrated in the cells of your body’s “workhorse” organs — like your brain and your heart. But CoQ10 is also a potent antioxidant, protecting important proteins and mitochondrial DNA from oxidative damage. Unfortunately, CoQ10 levels naturally deplete over time.Coenzyme Q10 depletion: natural and unnatural causesCoQ10 levels in your body naturally decrease as we age. And so-called “statin” drugs used to lower cholesterol also deplete CoQ10 levels in the blood and possibly in tissue as well.  Statin drugs have been shown to reduce plasma CoQ10 by nearly 40%. Alarmingly, the normal aging process may deplete CoQ10 levels even faster than the use of statin medications!The aging process reduces CoQ10 levels in the heart muscle wall by 72%. The frightening result is that the dual effects of aging and using statin drugs simultaneously could result in a severe CoQ10 deficit, leading to seriously diminished cellular vitality in vital organs like your heart. Superior availability of ubiquinol CoQ10Remember, traditional ubiquinone forms of CoQ10 are notoriously difficult for your body to absorb. And since the most important factor of any supplement is how much nutrient actually makes it into your bloodstream, you should know that scientific studies show ubiquinol CoQ10 absorbs up to 8 times greater than ubiquinone.Clinically studied effects on aging and fatigue In studies measuring exercise-induced fatigue, ubiquinol CoQ10 (like that in Super Ubiquinol CoQ10) was 90% more effective than ubiquinone. Furthermore, ubiquinol has been shown to be 40% more effective in slowing measurements of aging, compared to ubiquinone.Promote heart health and cellular vitalitySupport your heart, promote healthy mitochondrial function, and maintain vital cellular energy production. ChooseSuper Ubiquinol CoQ10 — the highly bioavailable ubiquinol form of CoQ10 in a patented delivery system with a superior absorption level.
Selengkapnya
Kunjungi Toko
Puritan Pride Vita-Min Multivitamin (Complete Formula #1) isi 100 butir at 120000.00 IDR from Lazada
Puritan Pride Vita-Min Multivitamin (Complete Formula #1) isi 100 butir
Rp 120.000
Lazada
Kunjungi Toko
Doctor's Best High Absorption CoQ10 with BioPerine 400 mg 180 Veggie Caps at 766000.00 IDR from iHerb
Doctor's Best High Absorption CoQ10 with BioPerine 400 mg 180 Veggie Caps
Rp 766.000
iHerb
Science-Based Nutrition Dietary Supplement Supports Heart Function, Energy Production in Cells Naturally Fermented Pharmaceutical Grade CoQ10 Vegan High Absorption CoQ10 contains pure coenzyme Q10, plus BioPerine. CoQ10 is a nutrient that supports heart function and promotes energy production in cells. BioPerine, an herbal extract derived from black pepper fruit, promotes absorption of nutrients in the GI tract. Preliminary studies have shown that BioPerine increases CoQ10 absorption.
Selengkapnya
Kunjungi Toko
Natures Own Men's Multivitamin Mega Potency 60 Tbl Stamina Daya Tahan at 263000.00 IDR from Lazada
Natures Own Men's Multivitamin Mega Potency 60 Tbl Stamina Daya Tahan
Rp 263.000
Lazada
Kunjungi Toko
Rainbow Light Just Once Prenatal One Food-Based Multivitamin 150 Tablets at 565000.00 IDR from iHerb
Rainbow Light Just Once Prenatal One Food-Based Multivitamin 150 Tablets
Rp 565.000
iHerb
#1 Natural Prenatal Brand† Just 1 Once Complete Nutrition for Mom & Baby Energizes, Eases Discomfort & Non-Constipating Easy to Digest with Probiotics & Enzymes Vegan - Gluten-Free Dietary Supplement#1 Natural Prenatal Multivitamin - complete food-based nutrition. Just 1 tablet per day supports Mom and Baby from conception through nursing.Nourishes Mom's Healthy and Baby's Development 800 mcg folic acid • non-constipating iron • B vitamins • choline • 2:1 calcium to magnesium • vitamins D & KEnhances cell & immune health, & natural energyAntioxidants • B vitamins • Gentle Prenatal Food BlendEases muscle aches & discomfort Magnesium • ginger • vitamins C, K & B6 Easy digestion: can be taken on an empty stomachProbiotics • plant-source enzymes • organic spirulina
Selengkapnya
Kunjungi Toko
 Flintstones Complete Children's Multivitamin Supplement 150 Chewable Tablets at 232000.00 IDR from iHerb
Flintstones Complete Children's Multivitamin Supplement 150 Chewable Tablets
Rp 232.000
iHerb
Now with More† Vitamin D To Support Strong Bones New Tasti Smooth Delicious Smooth Chewables Pediatricians #1 Choice For Children’s Chewable Vitamins † With 50% DV more Vitamin D than pervious formula (600 IU vs. 400 UU)
Selengkapnya
Kunjungi Toko
Blackmores Glucosamine Sulfate 1500mg 180 Caps [Bmgs1500Mg180C] at 479000.00 IDR from Bhinneka
Blackmores Glucosamine Sulfate 1500mg 180 Caps [Bmgs1500Mg180C]
Rp 479.000
Bhinneka
Memperlambat kerusakan sendi pada osteoartritis, Meningkatkan mobilitas sendi dan mengurangi kekakuan sendi, Mengurangi keausan tulang rawan
Selengkapnya
Kunjungi Toko
Life Extension Super Ubiquinol CoQ10 with BioPQQ 100 mg 30 Softgels at 545000.00 IDR from iHerb
Life Extension Super Ubiquinol CoQ10 with BioPQQ 100 mg 30 Softgels
Rp 545.000
iHerb
Enhanced Mitochondrial Support Dietary Supplement Kaneka QH Ubiquinol Coenzyme Q10 (CoQ10 for short) is a potent antioxidant that supports cardiovascular health and is absolutely essential for healthy mitochondrial function. The traditional form of CoQ10, ubiquinone, is difficult for your body to absorb — but the ubiquinol formlike that in Super Ubiquinol CoQ10 absorbs up to 8 times better!
Selengkapnya
Kunjungi Toko
Rainbow Light Just Once Men's One Food-Based Multivitamin 150 Tablets at 518000.00 IDR from iHerb
Rainbow Light Just Once Men's One Food-Based Multivitamin 150 Tablets
Rp 518.000
iHerb
#1 Natural Men's Multivitamin Brand New Look, Same Formula! Promotes Heart, Prostate & Sexual Health Boosts Energy & Stamina Levels Easy to Digest with Probiotics & Enzymes Gluten-Free | Soy-Free Dietary Supplement BPA Free Bottle Naturally energizes, strengthens, and protects the major systems of a man's body. Just one tablet of our food-based Men's One multivitamin goes beyond minimal daily values to deliver clinically researched key nutrients in forms that are easy for your body to absorb. Heart, immune, muscle, prostate & sexual health. Potent vitamins & minerals: A, B, C, D3, E, zinc, selenium, saw palmetto & natural lycopene, antioxidants Energy, stamina & stress management. Men's strengthening blend, Potent B complex, Whole foods Brain & nervous system health, B6 & B12, choline. Easy to digest: can be taken on an empty stomach, Fast-acting probiotics, plant-source enzymes
Selengkapnya
Kunjungi Toko
Solgar Ubiquinol (Reduced CoQ10) 200 mg 30 Softgels at 524000.00 IDR from iHerb
Solgar Ubiquinol (Reduced CoQ10) 200 mg 30 Softgels
Rp 524.000
iHerb
Since 1947 Advanced Antioxidant Support Gluten, Wheat & Dairy Free Dietary Supplement Coenzyme Q-10 (as ubiquinol) performs several important health supporting roles in the body. Ubiquinol (the reduced form of CoQ-10) provides advanced antioxidant support. By supplementing with Ubiquinol, you are providing your body with a form of CoQ-10 that is in a ready-to-use state to help fight free radicals. Free radicals can cause oxidative stress which may damage cells. Solgar Ubiquinol 200 mg is offered in oil-based softgels to ensure optimal absorption and assimilation.
Selengkapnya
Kunjungi Toko
Blackmores Premium Omega 3 Fish Oil 1000mg 400 Kapsul [Bmoo3400Capslv] at 389000.00 IDR from Bhinneka
Blackmores Premium Omega 3 Fish Oil 1000mg 400 Kapsul [Bmoo3400Capslv]
Rp 389.000
Bhinneka
Menjaga kesehatan jantung & meningkatkan fungsi otak, Menurunkan kolesterol & darah tinggi, membantu mengatasi rheumatik, 100% made in Australia
Selengkapnya
Kunjungi Toko
Rainbow Light NutriStart Multivitamin Powder 25 Easy-Mix Packets 1.9 oz (53 g) at 241000.00 IDR from iHerb
Rainbow Light NutriStart Multivitamin Powder 25 Easy-Mix Packets 1.9 oz (53 g)
Rp 241.000
iHerb
25 Easy-Mix Packets Food-Based Nutrition for Infants & Toddlers Provides Essential Nutrients + Whole Foods Supports Healthy Development & Brain Function Immunue Health & Gentle Digestion with Probiotics No Artificial Colors, Flavors or Sweeteners Gluten-Free | Dairy-Free Dietary Supplement #1 Natural Prenatal Brand† Rapidly growing infants and toddlers need specifically targeted levels of vitamins and minerals. Yet since children can be finicky eaters, they don’t always get the optimal balance of nutrients from diet alone. Sweetened only with natural fructose and whole fruit powders, NutriStart Multivitamin Powder is a convenient way to give even the youngest nutritional support they need. Your child will love the subtle fruit flavor, with no vitamin aftertaste! The most comprehensive nutritional supplement powder to support your child’s optimal growth and development. The first two years of your child’s life are the most critical for providing a proper nutritional foundation. Yet many young children do not meet the recommended levels of key nutrients, such as vitamin E, iron and zinc. NutriStart Multivitamin Powder helps fill in the gaps, with research-based levels of essential vitamins and minerals, plus nutrient-dense whole foods, to meet the unique nutritional needs of your young child. This neutral serve packets, and mixes easily into formula, applesauce, cereal or yogurt. Comprehensive multivitamin supports optimal growth & development Essential vitamins & minerals Antioxidant Fruit Blend organic apple & banana powders Supports a healthy brain & nervous system B-complex vitamins, including folic acid choline iron Immune health support & gentle digestion Targeted probiotics vitamins A,C, D & E selenium zinc †SPIN Data
Selengkapnya
Kunjungi Toko
California Gold Nutrition CoQ10 400 mg 60 Softgels at 471000.00 IDR from iHerb
California Gold Nutrition CoQ10 400 mg 60 Softgels
Rp 471.000
iHerb
Helps support supplementation for aging adults and those using statins*Promotes cardiovascular health*No GlutenNo GMOsNo SoyDietary Supplement100% Gold Guarantee ¹Our USP Grade CoQ10 is produced using a proprietary fermentation process. CoQ10 helps supportheart health and is a co-enzyme involved in energy production at the cellular level.* Over time many factors can deplete CoQ10 levels in the body, such as stress, aging and certain medications. This vital antioxidant is an essential supplement for protecting your body’s health. Our CoQ10 is USP Grade.
Selengkapnya
Kunjungi Toko
Mr Pro Multivitamin Tubuh at 250000.00 IDR from Lazada
-16%
Mr Pro Multivitamin Tubuh
Rp 250.000 Rp 300.000
Lazada
Kunjungi Toko
Salmon Fish Oil Minyak Ikan Salmon Suplemen [50 Kapsul] at 45000.00 IDR from Blibli
-25%
Salmon Fish Oil Minyak Ikan Salmon Suplemen [50 Kapsul]
Rp 45.000 Rp 60.000
Blibli
Salmon Fish Oil Minyak Ikan Salmon Suplemen [50 Kapsul] merupakan minyak ikan dengan kandungan proteinnya yang tinggi sehingga bagus untuk pertumbuhan. Selain kandungan protein dan rasanya yang enak, ikan juga mengandung omega 3, Vitamin C, Vitamin E dan berbagai antioksidan  yang bermanfaat bagi tubuh. Omega 3 seperti kita ketahui bersama sangat bermanfaat untuk otak kita. Dalam omega 3 banyak terkandung DHA (Docosahexaenoic Acid), EPA (Eicosapentaenoic Acid), dan LNA (Linolenic Acid). Ketiga senyawa inilah yang sangat berpengaruh terhadap pertumbuhan sel-sel otak. Apabila orang kekurangan omega 3 maka ia akan menjadi mudah lupa, kelelahan dan kemampuan otak semakin melemah. Komposisi : Minyak Ikan Salmon 100% Aturan pakai : Penyembuhan : 3x2 kapsul/hari Penjagaan : 3x1 kapsul/hari Balita : 1 kapsul/hari Kandungan & khasiat minyak ikan salmon : Omega 3 hingga 70% yang dapat menurunkan kolesterol buruk (Ldl) dan menaikan kolesterol baik (Hdl) Meningkatkan sel-sel darah merah hingga 47% Memperbaiki retina mata Menanggulangi ashma DHA yang dapat mempertajam daya pikir, sehingga tidak mudah lupa dan cerdas EPA yang mampu mencegah kanker, pembekuan darah, stroke, hipertensi Karatenoid astaxanthin, zat anti aging, dan antioksidan yang berlipat ganda lebih kuat dengan Vitamin C dan Vitamin E Sumber protein untuk masa pertumbuhan anak dan pembentukan badan yang berisi Vitamin A dan D
Selengkapnya
Kunjungi Toko
Puritan ABC Plus Senior Multivitamin & Mineral - |120Cap at 166000.00 IDR from Tokopedia
Puritan ABC Plus Senior Multivitamin & Mineral - |120Cap
Rp 166.000
Tokopedia
Usia 50 adalah tonggak sejarah. Memasuki fase ini, kita akan melihat ada perbedaan dalam kesehatan Anda, atau tingkat energi Anda. Para ahli gizi mengatakan ini adalah waktu yang penting untuk mengevaluasi pola makan Anda sehingga Anda tetap dapat aktif seperti yang Anda inginkan. Itulah sebabnya penting sekali bagi para senior untuk mendapatkan multivitamin dan mineral yang diformulasikan khusus untuk mencukupi kebutuhan pria dan wanita yang mencapai usia ini. Puritans Pride ABC Plus Senior Multivitamin Multi-Mineral Formula merupakan racikan khusus berkualitas tinggi dengan 31 vitamin dan mineral yang diformulasikan khusus untuk orang dewasa 50 tahun ke atas; memberikan 100% atau lebih sehari-hari nilai-nilai dari Vitamin C, D, E, B-2, Niacin, Asam Folat dan B-12. Suplemen ini diracik untuk jantung sehat dan bebas besi. Silakan bandingkan komposisinya dengan produk sejenis, dan dapatkan harga hematnya dari kami. exp 10/18 Fresh Product Mengonsumsi 1 kaplet per hari akan memberikan daya tahan tubuh yang lebih baik, serta menyediakan kelengkapan nutrisi bagi tubuh anda.
Selengkapnya
Kunjungi Toko
Herbal Indo Utama Cardiocare Suplemen Kesehatan [60 Kapsul] at 65000.00 IDR from Blibli
-21%
Herbal Indo Utama Cardiocare Suplemen Kesehatan [60 Kapsul]
Rp 65.000 Rp 83.000
Blibli
Herbal Indo Utama Cardiocare Suplemen Kesehatan [60 Kapsul] merupakan suplemen kesehatan yang memiliki manfaat untuk menyembuhkan bengkak pada kaki disebabkan pengumpulan lendir di pembuluh darah dan mampu mencegah serta mengatasi gangguan jantun. Selain itu dapat membantu mencegah penyumbatan pembuluh darah serta  penyakit jantung korone. POM TR. 133 369 491 Halal Lppom MUI No. 12270003591213 Note : Jangan diminum berdekatan dengan waktu makan atau waktu mengkonsumsi obat Jantung lain Minimal beri Jeda selama 1 Jam, baik sebelum atau setelah mengkonsumsi makanan dan atau obat lainnya
Selengkapnya
Kunjungi Toko
Blackmores Bio Ace Excell (80) at 333000.00 IDR from JD.ID
-23%
Blackmores Bio Ace Excell (80)
Rp 333.000 Rp 435.000
JD.ID
Blackmores bio ace excell (80)
Selengkapnya
Kunjungi Toko
Blackmores Omega Daily BPOM Kalbe 90 Kapsul at 274000.00 IDR from Lazada
Blackmores Omega Daily BPOM Kalbe 90 Kapsul
Rp 274.000
Lazada
Harga diperbarui pada 22 Jun 2017

Jaga Kesehatan dan Tetap Berstamina dengan Multivitamin di iprice Indonesia

Dewasa ini, gaya hidup sehat memang menghangat dan menjamur di kalangan kaum urban di Indonesia. Tidak mengherankan jika kini dengan mudah Anda temui berbagai komunitas untuk berolahraga bersama, baik di hari kerja ataupun hari libur. Selain itu, mengkonsumsi suplemen makanan berupa multivitamin pun kini menjadi tren di kalangan konsumen Indonesia. Karena, dengan mengkonsumsi suplemen makanan berupa multivitamin, Anda tidak perlu lagi mengukur nutrisi dari makanan yang Anda konsumsi secara manual.

Ragam Produk Multivitamin di iprice Indonesia

Menjaga kesehatan tentu salah satu kebutuhan kaum urban yang identik dengan aktivitas yang beragam sepanjang hari. Meskipun tampak mudah untuk dilakukan, menjaga kesehatan sebenarnya memerlukan usaha yang lebih. Mulai dari menjaga pola makan yang sehat dan tidak banyak mengandung kolesterol dan juga lemak, hingga berolahraga secara rutin adalah cara-cara yang bisa dilakukan untuk menjaga kesehatan tubuh kita di tengah banyaknya aktivitas kita sehari-hari.

Namun, tentu saja tidak semua orang dapat menjaga pola makan sehari-hari ataupun berolahraga secara rutin. Karena itu, mengkonsumsi multivitamin adalah salah satu cara paling mudah yang bisa dilakukan oleh mereka yang ingin sehat, namun tidak memiliki banyak waktu untuk menyiapkan makanan sendiri ataupun berolahraga rutin.

Memahami adanya kebutuhan konsumen Indonesia, baik pria dan wanita untuk mengkonsumsi multivitamin, kini iprice Indonesia menghadirkan rangkaian produk multivitamin secara online untuk kemudahan Anda mendapatkan produk multivitamin yang sesuai dengan kebutuhan Anda. Beberapa produk multivitamin favorit di iprice Indonesia di antaranya adalah:

  • Dermalogica Age Smart MultiVitamin Power Firm
  • Ultradent UltraCal Multivitamin & Calcium

Dermalogica Age Smart Multivitamin Power Firm adalah produk multivitamin dengan kandungan vitamin A, vitamin E dan vitamin C yang berfungsi untuk menjaga kesehatan sel kulit Anda serta kesehatan mata Anda. Sedangkan Ultradent UltraCal Multivitamin & Calcium adalah jenis produk multivitamin yang berfungsi untuk meningkatkan struktur tulang dengan mengoptimalkan proses penyerapan kalsium di tubuh Anda

Selain dua jenis multivitamin di atas, iprice Indonesia pun memiliki beragam merek multivitamin terkemuka yang bisa Anda dapatkan. Mulai dari multivitamin Blackmores hingga multivitamin Natural Factors bisa Anda dapatkan dengan mudah melalui iprice Indonesia. Jangan sampai ketinggalan!

Tips Memenuhi Kebutuhan Vitamin Harian Anda Secara Alami

Meskipun kini sudah tersedia dalam beragam produk yang aman untuk Anda konsumsi karena menggunakan bahan-bahan alami, namun tentu saja untuk memenuhi kebutuhan tubuh kita akan vitamin paling baik dilakukan secara alami. Beberapa tips di bawah ini dapat Anda lakukan untuk memenuhi kebutuhan vitamin tubuh Anda secara alami.

  1. Konsumsi buah-buahan. Bukan rahasia lagi bahwa buah-buahan yang memiliki warna mencolok seperti jeruk ataupun strawberry memiliki kandungan vitamin C yang tinggi. Biasakan mengkonsumsi buah-buahan setiap hari dapat membantu Anda memenuhi kebutuhan vitamin C harian.
  2. Tambahkan sayuran dalam masakan Anda. Ya, benar, sayur-sayuran mengandung banyak vitamin dan mineral yang dibutuhkan oleh tubuh kita. Jadi jangan sampai ketinggalan untuk menyertakan berbagai sayuran dalam menu harian Anda.
  3. Keluar rumah ketika matahari pagi bersinar. Matahari pagi mengandung vitamin D dan juga vitamin E yang dibutuhkan untuk menjaga kesehatan kulit dan tulang kita.

Jangan sampai ketinggalan untuk selalu mendapatkan vitamin alami yang bisa Anda lakukan tanpa mengeluarkan uang sedikitpun.


Hai, kami ingin tahu pendapat Anda tentang kami

Kami menghargai privasi Anda, email yang diberikan hanya digunakan untuk menanggapi saran dari Anda.

Terima Kasih